PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA55G00025
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 260aa    MW: 30137.4 Da    PI: 9.0174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA55G00025genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.18.5e-131663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l   +  +G  +W+t++   g+ R +k+c++rw +yl
       AA55G00025 16 KGLWSPEEDQKLSSFIFSHGHACWTTVPIQAGLQRNGKSCRLRWINYL 63
                     678*******************************************97 PP

2Myb_DNA-binding50.16.4e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ +E+  ++ ++  lG++ W++Ia++++ gRt++++k++w++yl
       AA55G00025  69 RGTFSSDEENTILTLHSSLGNK-WSRIAKYLP-GRTDNEIKNYWHSYL 114
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-191166IPR009057Homeodomain-like
PROSITE profilePS5129413.5241163IPR017930Myb domain
SuperFamilySSF466891.14E-2613110IPR009057Homeodomain-like
SMARTSM007172.0E-81565IPR001005SANT/Myb domain
PfamPF002492.5E-111663IPR001005SANT/Myb domain
CDDcd001678.83E-71963No hitNo description
PROSITE profilePS5129424.45464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-2567118IPR009057Homeodomain-like
SMARTSM007178.8E-1568116IPR001005SANT/Myb domain
PfamPF002497.2E-1569114IPR001005SANT/Myb domain
CDDcd001671.05E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MGKTKSGERP KQRQRKGLWS PEEDQKLSSF IFSHGHACWT TVPIQAGLQR NGKSCRLRWI  60
NYLRPGLKRG TFSSDEENTI LTLHSSLGNK WSRIAKYLPG RTDNEIKNYW HSYLKKKWLK  120
THPKTETQRS SSSSSSSSLL ASGTRNLEAE TETLDRLISF KNPSLSSEMN NFPNLFFSDW  180
ITSSDPQINF SSTLQDSKKI NYKPEEIIHD YDRFHYEEMM VNNNFSDFIF ATDIQQSDEC  240
SHYQNSSAQF FLNSNDGNYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24161177107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010444657.11e-112PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K42e-86LAF1_ARATH; Transcription factor LAF1
TrEMBLQ9LTJ51e-105Q9LTJ5_ARATH; MYB transcription factor
TrEMBLV4LTS71e-105V4LTS7_EUTSA; Uncharacterized protein
STRINGAT5G52260.11e-105(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.11e-105myb domain protein 19